DZone
Thanks for visiting DZone today,
Edit Profile
  • Manage Email Subscriptions
  • How to Post to DZone
  • Article Submission Guidelines
Sign Out View Profile
  • Post an Article
  • Manage My Drafts
Over 2 million developers have joined DZone.
Log In / Join
Refcards Trend Reports
Events Video Library
Refcards
Trend Reports

Events

View Events Video Library

Related

  • Two-Pass Huffman in Blocks of 2 Symbols: Golang Implementation
  • Exploring Exciting New Features in Java 17 With Examples
  • Doubly Linked List in Data Structures and Algorithms
  • Linked List in Data Structures and Algorithms

Trending

  • Why Internal Tools Waste So Much Engineering Time
  • Working With Spreadsheets in Java: A Practical Overview
  • Understanding Agentic SDLC: The Future of Software Engineering
  • How to Write for DZone Publications: Trend Reports and Refcards
  1. DZone
  2. Data Engineering
  3. Data
  4. Algorithm of the Week: Data Compression with Bitmaps

Algorithm of the Week: Data Compression with Bitmaps

By 
Stoimen Popov user avatar
Stoimen Popov
·
Jan. 17, 12 · Interview
Likes (0)
Comment
Save
Tweet
Share
20.5K Views

Join the DZone community and get the full member experience.

Join For Free

In my previous post we saw how to compress data consisting of very long runs of repeating elements. This type of compression is known as “run-length encoding” and can be very handy when transferring data with no loss. The problem is that the data must follow a specific format. Thus the string “aaaaaaaabbbbbbbb” can be compressed as “a8b8”. Now a string with length 16 can be compressed as a string with length 4, which is 25% of its initial length without loosing any information. There will be a problem in case the characters (elements) were dispersed in a different way. What would happen if the characters are the same, but they don’t form long runs? What if the string was “abababababababab”? The same length, the same characters, but we cannot use run-length encoding! Indeed using this algorithm we’ll get at best the same string.

In this case, however, we can see another fact. The string consists of too many repeating elements, although not arranged one after another. We can compress this string with a bitmap. This means that we can save the positions of the occurrences of a given element with a sequence of bits, which can be easily converted into a decimal value. In the example above the string “abababababababab” can be compressed as “1010101010101010”, which is 43690 in decimals, and even better AAAA in hexadecimal. Thus the long string can be compressed. When decompressing (decoding) the message we can convert again from decimal/hexadecimal into binary and match the occurrences of the characters. Well, the example above is too simple, but let’s say only one of the characters is repeating and the rest of the string consists of different characters like this: “abacadaeafagahai”. Then we can use bitmap only for the character “a” – “1010101010101010” and compress it as “AAAA bcdefghi”. As you can see all the example strings are exactly 16 characters and that is a limitation. To use bitmaps with variable length of the data is a bit tricky and it is not always easy (if possible) to decompress it.

 

Bitmap Compression

Basically bitmap compression saves the positions of an element that is repeated very often in the message!



In the other hand bitmap compression is not only applicable on strings. We can compress also arrays, objects or any kind of data. The example from my previous post is very suitable. Then we had to transfer a large array from a server to the client (browser) using JSON. The data then was very suitable for “run-length encoding”. Now let’s assume we have the same data – a set of different years, which this time are dispersed in a different way.

$data = array(
	0 	=> 1991,
	1 	=> 1992,
	2 	=> 1993,
	3 	=> 1994,
	4 	=> 1991,
	5 	=> 1992,
	6 	=> 1993,
	7 	=> 1992,
	8 	=> 1991,
	9 	=> 1991,
	10 	=> 1991,
	11 	=> 1992,
	12 	=> 1992,
	13 	=> 1991,
	14 	=> 1991,
	15 	=> 1992,	
	...
);

The JSON will encoded message will be the following (a simple but yet very large javascript array).

[1991,1992,1993,1994,1991,1992,1993,1992,1991,1991,1991,1992,1992,1991,1991,1992, ...]

However if we use bitmap compression we’ll get a “shorter” array.

$data = array(
	0 => array(1991, '1000100011100110'),
	1 => array(1992, '0100010100011001'),
	2 => array(1993, '0010001000000000'),
	3 => array(1994, '0001000000000000'),
);

Now the JSON is:

[[1991,"1000100011100110"],[1992,"0100010100011001"],[1993,"0010001000000000"],[1994,"0001000000000000"]]

It is obvious that the compression ratio is getting better and better as the uncompressed data grows. In fact, most of us know bitmap compression from images, because this algorithm is largely used for image compression. We can imagine how successful it can be when compressing black and white images (as black and white can be represented as 0 and 1s). Actually it is used for more than two colors (256 for instance) and again the level of compression is very high.

Implementation

The following implementation on PHP aims only to illustrate the bitmap compressing algorithm. As we know this algorithm can be applicable for any kind of data structures.

// too many repeating "a" characters
$msg = 'aazahalavaatalawacamaahakafaaaqaaaiauaacaaxaauaxaaaaaapaayatagaaoafaawayazavaaaazaaabararaaaaakakaaqaarazacajaazavanazaaaeanaaoajauaaaaaxalaraaapabataaavaaab';
 
function bitmap($message) 
{
	$i = 0;
	$bits = $rest = '';
 
	while ($v = $message[$i]) {
		if ($v == 'a') {
			$bits .= '1';
		} else {
			$bits .= '0';
			$rest .= $v;
		}
		$i++;
	}
 
	return number_format(bindec($bits), 0, '.', '') . $rest;;
}
 
echo bitmap($msg);
 
// uncompressed: 
acaaaaadaaaabalaaeaaaaganaaxakaavawamaasavajawaaaayaauaaadalanagaeaeamaarafalaazaaaiasaanaahaaazaraxaalaahaaawaaajasamahaajaakarapanaakaoakaanawalaacamauaamaal
// compressed:
152299251941730035874325065523548237677352452096zhlvtlwcmhkfqiucxuxpytgofwyzvzbrrkkqrzcjzvnzenojuxlrpbtvb

Application

This algorithm is very useful when there is an element in our data that repeats very often, so you need to investigate the nature of the data you want to compress. Actually because of this fact this algorithm is used for image compression as PNG8 or GIF.

 

Source: http://www.stoimen.com/blog/2012/01/16/computer-algorithms-data-compression-with-bitmaps/

 

Data (computing) Bitmap Algorithm Data compression Strings Data Types

Opinions expressed by DZone contributors are their own.

Related

  • Two-Pass Huffman in Blocks of 2 Symbols: Golang Implementation
  • Exploring Exciting New Features in Java 17 With Examples
  • Doubly Linked List in Data Structures and Algorithms
  • Linked List in Data Structures and Algorithms

Partner Resources

×

Comments

The likes didn't load as expected. Please refresh the page and try again.

  • RSS
  • X
  • Facebook

ABOUT US

  • About DZone
  • Support and feedback
  • Community research

ADVERTISE

  • Advertise with DZone

CONTRIBUTE ON DZONE

  • Article Submission Guidelines
  • Become a Contributor
  • Core Program
  • Visit the Writers' Zone

LEGAL

  • Terms of Service
  • Privacy Policy

CONTACT US

  • 3343 Perimeter Hill Drive
  • Suite 215
  • Nashville, TN 37211
  • [email protected]

Let's be friends:

  • RSS
  • X
  • Facebook